Mutation du virus à Londres, faut-il redouter un SARS-CoV-3 ? Le conseil de défense s’est réuni – AgoraVox

Mutation du virus à Londres, faut-il redouter un SARS-CoV-3 ? Le conseil de défense s’est réuni – AgoraVox

PNG

 Crédit photo : Wikimedia Commons

 1) Un an après les premiers cas de Covid détectés à Wuhan, les autorités britanniques nous alertent sur ce qui est présenté comme un variant, une lignée, une souche du SARS-CoV-2. L’affolement des gouvernements et des médias laissent penser que le Londres de décembre 2020 ressemble au Wuhan de janvier 2020 ; et donc qu’il faut déclarer Londres zone interdite en annulant les vols depuis cette destination, puis en supprimant les trains. Un conseil de défense s’est même réuni à l’Elysée ce dimanche à 17 heures, avec le président en visioconférence. Quelques mutations sur un petit génome produisent un effet sismique sur les gouvernements, c’est ce qu’on appelle l’effet papillon.

 Est-ce un nouveau virus ou un variant plus agressif ? Les autorités affirment que ce variant serait plus contagieux mais pas plus dangereux sur le plan clinique et qu’il n’impacterait pas la vaccination. Autrement dit, ce virus circule plus vite et c’est ce qui inquiète les autorités car la stratégie sanitaire consiste à contenir la propagation du virus. Ce n’est pas la meilleure stratégie mais c’est celle qui est choisie et forcément, si un variant s’avère plus contagieux, cela est très ennuyeux. Faut-il s’inquiéter de la propagation de ce nouveau variant ? Pour répondre à cette interrogation, il est recommandé de se baser sur les éléments scientifiques établis par les virologues. Une étude préliminaire a été publiée le 19 décembre. Nous avons accès aux différentes modifications de ce variant et nous savons qu’il a circulé depuis un mois au Royaume-Uni, non seulement à Londres mais aussi en Ecosse et au Pays de Galles, plus quatre autres pays qui ne sont pas cités par les auteurs de cette étude.

 

 2) Le nouveau variant a subi 23 mutations nucléotidiques sur une séquence de 30 000 bases, ce qui représente moins de 0.1% de divergence par rapport au virus de Wuhan séquencé en janvier. Le chiffre de 24 n’a rien d’exceptionnel. Les variants circulant actuellement ont accumulé 10 à 15 mutations en moyenne. Sur les 24 mutations du nouveau variant, 17 sont non synonymes et produisent un changement sur une des protéines virales. Le nombre de substitution d’acides aminés est colossal, plus de 30 000 sont enregistrées. Rien que pour la protéine S, quelque 5000 substitutions ont été répertoriées. La plupart des mutations sont sans incidence sauf celles qui ont une incidence aurait dit Monsieur de la Palice. Les virologues surveillent de près les mutations sur la protéine Spike, devenue pratiquement une sorte de totem en covidologie. C’est par cette protéine formant une protubérance sur l’enveloppe que le virus entre dans la cellule pour l’infecter. Le nouveau variant présente 8 mutations sur S dont deux sont prises au sérieux par les virologues

 

 3) La protéine S du nouveau variant possède deux délétions mineures sur la partie N-terminale de S1, deux substitutions sur la sous-unité S2 côté C-terminal, une sur la sous-unité S1 côté C-terminal. Il reste deux substitutions sur le domaine RBD de liaison au récepteur ACE2, ce qui n’a rien d’étonnant car ce domaine est connu pour sa variabilité, contrairement à d’autres domaines et notamment le domaine de fusion FP situé sur la sous-unité S2 qui est extrêmement conservé. Les deux substitutions sur RBD ont comme nom de code N501Y et A570D. La mutation 501 aurait une incidence sur la liaison de la protéine, augmentant son affinité assortie d’une contagiosité observée sur des modèles animaux. Il reste la mutation P681H qui n’a rien d’anodin car elle se situe sur le site de clivage de la furine. Les deux mutations sensibles, 501 et 681 n’ont rien de récent, elles ont été observées depuis des mois. La 501 a circulé en Australie dans la région de Melbourne ; elle a été repéré au Brésil, dans quelques localités américaines ; elle n’indique pas spécialement une contagiosité exceptionnelle ; si tel était le cas, elle se serait répandue massivement. La 681 a été observée aux Baléares au début du printemps 2020, au Japon, puis elle s’est légèrement répandue en Inde et aux Etats-Unis pendant l’été et pour finir, au Royaume-Uni ce dernier mois. En fait, ce n’est pas chaque mutation qui inquiète les virologues mais la combinaison de ces deux mutations qui elle, est assez récente. Sans oublier les 15 autres mutations qui interpellent plus par leur nombre que par une réelle incidence sur la reproduction des virions. 

 

 4) Pour pénétrer dans une cellule hôte, le virion SARS-CoV-2 se lie sur le récepteur ACE2 puis doit fusionner avec la membrane pour basculer de l’autre côté. Il dispose de deux codes, furine et trypsine. C’est ce qui explique l’impact de cet agent infectieux ayant causé la pandémie de 2020. Il est pratiquement établi que le code furine est responsable de l’infection respiratoire supérieure, ce qui rend le virus très contagieux, alors que le code trypsine permet l’entrer dans l’épithélium pulmonaire, ce qui rend le virus très méchant. Le SARS de 2002 n’avait pas ce code furine ce qui explique la faible contagiosité et la maîtrise de cette épidémie. Le code trypsine est conservé sur la lignée des sarbecovirus occupant le réservoir chauves-souris, pangolins, civettes et depuis 2002 l’homme. Le code trypsine s’écrit skpskrs, il est suivi d’un peptide de fusion (fiedllfnkvtladagfikqygdc) conservé sur les coronavirus. Ce code figure sur des virus de chauve-souris et de pangolins. Il existe aussi dans le réservoir de 2002 incluant la civette mais avec cette variante skptskrs. C’est en quelque sorte la marque de fabrique des sarbecovirus où figurent les deux souches ayant causé quelques ennuis à l’homme. Voici le code trypsine situé sur la sous-unité S2 et qui dont le clivage est désigné comme S2’ :

 

801 nfsqilpdpskpskr↓sfiedllfnkvtladagfikqygdclgdiaardlicaqkfngltv

 

 En revanche, le code furine est assez énigmatique car on ne sait pas d’où il vient. Il est propre au SARS-CoV-2 et ne figure ni sur le SARS de 2002 ni sur les souches récupérées sur le pangolin ou la chauve-souris, comme la ZC41, la ZXC21 et la RaTG13 qui est la plus proche en homologie, sans oublier la Rc-0319 récupéré en 2013 au Japon et dont le séquençage vient d’être publié. Voici le code furine dont le clivage est désigné S1/S2 :

 

661 ecdipigagicasyqtqtnsprrar↓svasqsiiaytmslgaensvaysnnsiaiptnfti

 

 La substitution P681H modifie légèrement le code furine, sprrars devient shrrars. Cette mutation ne modifie pas le motif polybasique à arginine servant de code. Et qui une fois le clivage effectué, pourrait se fixer sur la neuropiline (C-end rule) et influencer l’entrée du virus (quelques résultats ont été publiés mais j’ignore si ce détail a une importance en épidémiologie, ni si quelques effets cliniques en découlent)

 

 5) La combinaison des mutations 501 et 681 n’a aucune raison de rendre le virus plus contagieux, autrement dit, d’augmenter significativement la reproduction des virions dans les tissus respiratoires. Pas plus qu’elle laisse penser à une plus grande dangerosité (qui du reste, est liée au site trypsine pour l’essentiel, sans oublier les mécanismes viraux permettant aux protéines virales de hacker les codes de la cellule hôte et de détourner son système de traduction tout en neutralisant les défenses immunitaires). Les autres mutations portent sur les protéines non structurales codées par la séquence ORF1ab. Deux mutations sont observées sur la protéine N mais ne devraient pas avoir d’incidence. La S235F substitue une sérine et aurait une incidence si elle modifiait une éventuelle phosphorylation. Restent les mutations sur la protéine codée par ORF 8 ; notamment celle qui porte sur le codon stop en 27 et qui conduit à une perte de fonction, autrement dit, une tendance à perdre en efficacité.

 Pourquoi ce variant s’est-il répandu si vite ? L’explication n’est pas forcément virologique. Il se peut très bien que ce variant se soit propagé entre personnes rassemblées en nombre lors d’une réunion ou une fête, ce qui a favorisé la propagation. Souvenez-vous du rassemblement évangéliste à Mulhouse. Un mégacluster s’est formé et le virus s’est répandu à une vitesse phénoménale en Alsace, se propageant ensuite dans d’autres lieux. C’est certainement par excès de précaution que le rapport préconise une surveillance internationale de ce variant qui accumule un nombre de mutations au-dessus de la moyenne, mais sans que cela ne justifie d’invoquer une nouvelle souche. Seule une recombinaison décisive pourrait créer une souche inédite. La nouvelle souche ressemble bien à une fiction médiatique. C’est une souche infodémique, qui s’est répandue sur tous les médias de masse. Cela dit, la prudence incline à ne pas tirer de conclusion définitive. Ce nouveau variant est au final une aubaine pour les réalisateurs collaboratifs de la série Covid, saison 2, prévue pour 2021.

 

Bernard Dugué, PhD, covidologue

 

 Etude préliminaire sur le variant de Londres

 

https://virological.org/t/preliminary-genomic-characterisation-of-an-emergent-sars-cov-2-lineage-in-the-uk-defined-by-a-novel-set-of-spike-mutations/563

 

 Traduction automatique de quelques extraits

 

 Caractérisation génomique préliminaire d’une lignée émergente du SRAS-CoV-2 au Royaume-Uni définie par un nouvel ensemble de mutations de Spike

 

 Report written by : Andrew Rambaut, Nick Loman, Oliver Pybus, Wendy Barclay, Jeff Barrett, Alesandro Carabelli, Tom Connor, Tom Peacock, David L Robertson, Erik Volz, on behalf of COVID-19 Genomics Consortium UK (CoG-UK)9.

 

University of Edinburgh

University of Birmingham

University of Oxford

Imperial College London

Wellcome Trust Sanger Institute

University of Cambridge

Cardiff University

MRC-University of Glasgow Centre for Virus Research

https://www.cogconsortium.uk 332

 

 

Résumé

Récemment, un cluster phylogénétique distinct (nommé lignée B.1.1.7) a été détecté dans l’ensemble de données de surveillance COG-UK. Cette grappe a connu une croissance rapide au cours des 4 dernières semaines et a depuis été observée dans d’autres localités du Royaume-Uni, indiquant une propagation supplémentaire.

 

Plusieurs aspects de ce groupe méritent d’être soulignés pour des raisons épidémiologiques et biologiques et nous rapportons les résultats préliminaires ci-dessous. En résumé :

la lignée B.1.1.7 représente une proportion croissante de cas dans certaines parties de l’Angleterre. Le nombre de cas B.1.1.7 et le nombre de régions signalant des infections B.1.1.7 sont en augmentation.

B.1.1.7 présente un nombre inhabituellement élevé de modifications génétiques, en particulier dans la protéine de pointe.

Trois de ces mutations ont des effets biologiques potentiels qui ont été décrits précédemment à des degrés divers :

 

La mutation N501Y est l’un des six résidus de contact clés dans le domaine de liaison au récepteur (RBD) et a été identifiée comme une affinité de liaison croissante avec l’ACE2 humaine et murine.

La délétion de pointe 69-70del a été décrite dans le contexte de l’évasion de la réponse immunitaire humaine mais s’est également produite un certain nombre de fois en association avec d’autres changements de RBD.

La mutation P681H est immédiatement adjacente au site de clivage de la furine, un emplacement connu d’importance biologique.

La croissance rapide de cette lignée indique la nécessité de renforcer la surveillance génomique et épidémiologique dans le monde entier et d’enquêter en laboratoire sur l’antigénicité et l’infectiosité.

 

Conclusion

Nous rapportons une lignée à croissance rapide au Royaume-Uni associée à un nombre étonnamment élevé de changements génétiques, y compris dans le domaine de liaison au récepteur et associés au site de clivage de la furine. Compte tenu (i) des conséquences phénotypiques plausibles et prédites expérimentalement de certaines de ces mutations, (ii) de leurs effets inconnus lorsqu’ils sont présents en combinaison, et (iii) du taux de croissance élevé de B.1.1.7 au Royaume-Uni, cette nouvelle lignée nécessite une caractérisation urgente en laboratoire et une surveillance génomique renforcée dans le monde entier.

 

‘);

//console.log(idf+ » => « +score);
$(‘#ulf div.notation input[name= »star’+idf+' »]’).rating({callback: vf}).rating(‘select’, Math.round(score-1));

if (score >= 2.5 && nbv > 4) {
$(« span#f »+idf).addClass(« nbv4 »);
if (nbv > 8) {
$(« span#f »+idf).addClass(« nbv8 »);
if (nbv > 12) {
$(« span#f »+idf).addClass(« nbv12 »);
if (nbv > 16) {
$(« span#f »+idf).addClass(« nbv16 »);
}
}
}
}
}

vf = function(value, link) {
try {
if (typeof vc_ok == ‘undefined’ || !vc_ok) return;

var url = document.nf.action;
var faa = document.nf.formulaire_action_args.value;
var n = $(this).attr(‘name’);
var idf = n.substr(4);
//debugger;

$.post(url,
{ ‘formulaire_action’: ‘notation_forum1form’, ‘formulaire_action_args’: faa, ‘var_ajax’:’form’,’idf’:idf, ‘note’:value },
function(d,ts){
if (ts == ‘success’) {
$.getJSON(‘/json/?ida=229633&idf=’+idf, function(r) {
if (r.ok) {
var nba = r.nf[idf];
vc_ok = false;
updf($(‘span#f’+idf),idf,nba);
vc_ok = true;
}
});
}
});

} catch(err) {
//console.log(err.message);
}
}

/*
click_handler = function() {
var idf = $(this).attr(‘idf’);
var url = document.nf.action;
var faa = document.nf.formulaire_action_args.value;
var n = $(this).attr(‘name’);
$.post(url, { ‘formulaire_action’: ‘notation_forum1form’, ‘formulaire_action_args’: faa, ‘var_ajax’:’form’,’idf’:idf, ‘note’:n },
function(r,ts){
if (r.indexOf(« 

Laisser un commentaire

Votre adresse de messagerie ne sera pas publiée. Les champs obligatoires sont indiqués avec *

You have successfully subscribed to the newsletter

There was an error while trying to send your request. Please try again.

web-breaking-news will use the information you provide on this form to be in touch with you and to provide updates and marketing.